PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C014120P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family NF-YB
Protein Properties Length: 211aa    MW: 22862.4 Da    PI: 5.6599
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C014120P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB169.15.3e-5354150197
           NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                     vreqd+++Pianv+rim+++lP++akis+daket+qecvse+isf+t+ea+++cqre+rkt++++d+lwa+++lGf+dy+epl+v+l++yre e+
  MELO3C014120P1  54 VREQDQYMPIANVIRIMRRILPSHAKISDDAKETIQECVSEYISFITGEANERCQREQRKTVTAEDVLWAMGKLGFDDYIEPLTVFLNRYRESES 148
                     69*******************************************************************************************99 PP

           NF-YB  96 ek 97 
                     ++
  MELO3C014120P1 149 DR 150
                     86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.0E-4848150IPR009072Histone-fold
SuperFamilySSF471134.19E-3657150IPR009072Histone-fold
PfamPF008081.3E-2560124IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.3E-1588106No hitNo description
PROSITE patternPS00685091107IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.3E-15107125No hitNo description
PRINTSPR006151.3E-15126144No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0009785Biological Processblue light signaling pathway
GO:0010262Biological Processsomatic embryogenesis
GO:0045723Biological Processpositive regulation of fatty acid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MMVTPNKATS INNTPNSNHH LSNGGTATGN SSATSPLSVA ATANNNEQNQ QCVVREQDQY  60
MPIANVIRIM RRILPSHAKI SDDAKETIQE CVSEYISFIT GEANERCQRE QRKTVTAEDV  120
LWAMGKLGFD DYIEPLTVFL NRYRESESDR IRTEPILRRN VDYGPQVGMI SPYGQAFQIG  180
HVPAGMFDAM GGYYGGGGGG GPSAGNGSQL *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A4e-3955145393NF-YB
4awl_B4e-3955145494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A4e-3955145494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818600.0LN681860.1 Cucumis melo genomic scaffold, anchoredscaffold00021.
GenBankLN7132600.0LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008449191.11e-157PREDICTED: nuclear transcription factor Y subunit B-9
SwissprotQ9SFD82e-66NFYB9_ARATH; Nuclear transcription factor Y subunit B-9
TrEMBLA0A0A0L2U11e-125A0A0A0L2U1_CUCSA; Uncharacterized protein
STRINGVIT_00s0956g00020.t013e-72(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27283279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21970.12e-65NF-YB family protein